Structure of PDB 1t4f Chain M Binding Site BS01

Receptor Information
>1t4f Chain M (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQ
HIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t4f Discovery and cocrystal structure of benzodiazepinedione HDM2 antagonists that activate p53 in cells
Resolution1.9 Å
Binding residue
(original residue number in PDB)		L54 L57 G58 I61 M62 Y67 Q72 H73 V93 H96 Y100
Binding residue
(residue number reindexed from 1)		L32 L35 G36 I39 M40 Y45 Q50 H51 V71 H74 Y78
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1t4f, PDBe:1t4f, PDBj:1t4f
PDBsum1t4f
PubMed15715460
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]