Structure of PDB 1pp8 Chain M Binding Site BS01

Receptor Information
>1pp8 Chain M (length=118) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSNDLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQ
LEEEIGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKG
GWTQWKRSGFTRNSVFED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pp8 Structural Basis of Core Promoter Recognition in a Primitive Eukaryote
Resolution3.05 Å
Binding residue
(original residue number in PDB)		S26 R33 F34 I78 K79 N81 T82 N86
Binding residue
(residue number reindexed from 1)		S26 R33 F34 I78 K79 N81 T82 N86
Binding affinityPDBbind-CN: Kd=190nM
Enzymatic activity
Enzyme Commision number ?
External links