Structure of PDB 1nwy Chain M Binding Site BS01

Receptor Information
>1nwy Chain M (length=111) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATTIRRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAA
ASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKAL
ADAAREGGLDF
Ligand information
>1nwy Chain 9 (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccccgugcccauagcacuguggaaccaccccaccccaugccgaacuggg
ucgugaaacacagcagcgccaaugauacucggaccgcagggucccggaaa
agucggucagcgcggggg
<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>>>
..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>...
....>>>..>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nwy Structural basis for the antibiotic activity of ketolides and azalides.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		S34 T50
Binding residue
(residue number reindexed from 1)		S31 T47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1nwy, PDBe:1nwy, PDBj:1nwy
PDBsum1nwy
PubMed12623020
UniProtQ9RSL2|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]