Structure of PDB 1izl Chain M Binding Site BS01

Receptor Information
>1izl Chain M (length=347) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
INLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHI
ATLGWGVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLWKDKNKMTT
ILGFHLIVLGIGALLLVAKAMFFLYDTWAPGGGDVRVIKSPFGGEGWIVS
VNNLEDVVGGHIWIGLICIAGGIWHILTTGWARRAFIWSGEAYLSYSLGA
LSMMGFIATCFVWFNNTVYPAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAVGG
VATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFE
Ligand information
>1izl Chain W (length=27) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AYAIFDPLVDVLPVIPVLFLALAFVWQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1izl Crystal structure of oxygen-evolving photosystem II from Thermosynechococcus vulcanus at 3.7-A resolution
Resolution3.7 Å
Binding residue
(original residue number in PDB)		I43 W63 A66 M67 F70
Binding residue
(residue number reindexed from 1)		I1 W21 A24 M25 F28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009521 photosystem
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1izl, PDBe:1izl, PDBj:1izl
PDBsum1izl
PubMed12518057
UniProtQ8DIF8|PSBC_THEVB Photosystem II CP43 reaction center protein (Gene Name=psbC)

[Back to BioLiP]