Structure of PDB 1him Chain M Binding Site BS01

Receptor Information
>1him Chain M (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVAT
ISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRE
RYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPE
PVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVA
HPASSTKVDKKIEP
Ligand information
>1him Chain R (length=9) Species: 1184529 (Influenza A virus (A/reassortant/X-47(Victoria/3/1975 x Puerto Rico/8/1934)(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YDVPDYASL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1him Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S52 N52A G53 G55 Y56 Y58 R95 E96 R97 E100 P227
Binding residue
(residue number reindexed from 1)		S52 N53 G54 G56 Y57 Y59 R99 E100 R101 E104 P214
External links