Structure of PDB 6zj3 Chain Ll Binding Site BS01

Receptor Information

>6zj3 Chain Ll (length=124) Species: 3039 (Euglena gracilis)

VNKVGKSGDRRKARKSYFTAPSHVRRVIMSARLSKDLRQKYKVKSLPIRK
EDEVKVKRGSHKGRDGKVIACYRLKYAVHIDKITREKANGQTVQIGIHPS
NVEITKLKLDKDRKKLLETKGRRK

Ligand information

>6zj3 Chain LA (length=160)

accuguugugguggaugucuuggcccagguucugaggaaggacacagcag
ccuugcgauacguucggugauacgcagaucuugugaucuggacaaaggaa
cagcuucgaacgcaacuggccagcaagggguccccccgagcugccugugc
gccaguguug

.......................................<<<..<.((..
....>.........<<<......))............>>>..........
....>>>....<<.....>>.<<<..<<<<...>>>>..>>>........
..........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
• Resolution: 3.15 Å
• Binding residue (original residue number in PDB): R11 R12 R15 K16 F19 P22 S23 H24 R27 R50 K51 C72 Y73 R74 L75 L110 K112 D113 K115
• Binding residue (residue number reindexed from 1): R10 R11 R14 K15 F18 P21 S22 H23 R26 R49 K50 C71 Y72 R73 L74 L109 K111 D112 K114

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Apr 6 22:30:41 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Ll', bs = 'BS01', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Ll', bs='BS01', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003723,0003735,0006412,0015934', uniprot = '', pdbid = '6zj3', asym_id = 'Ll'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015934', uniprot='', pdbid='6zj3', asym_id='Ll')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>