Structure of PDB 8br8 Chain Lk Binding Site BS01

Receptor Information
>8br8 Chain Lk (length=85) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKGTASFGKRHTRIHGSCRRCGKHSFHLQKHECASCGYPSAKMRRYNWSY
KSLRRRTQGTGSMSHMRKVYRAYNSGTLKANARKY
Ligand information
>8br8 Chain LD (length=142) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcacgccccgccggcggaugccucggcccgggcggcgacgaagagcgcgg
cggagcgcgagacgcggugcggacccgcccgccccgagaagcaccgaucc
ucgaacgcagcgcgccccggcgccgccgccucggcgccugcc
..........................................<<<<<<<(
(....>>>>.....<<<<<<...<..))..>.........>>>>>>...>
>>....<<...>><<<..>>>.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		R20 R21 C22 G23 Y39 A42 R57 Q59 G60 T61 G62 M64 H66 M67 V70 Y71 Y74 S76 G77
Binding residue
(residue number reindexed from 1)		R19 R20 C21 G22 Y38 A41 R56 Q58 G59 T60 G61 M63 H65 M66 V69 Y70 Y73 S75 G76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum8br8
PubMed36912103
UniProtA8BLV7

[Back to BioLiP]