Structure of PDB 6zj3 Chain Lk Binding Site BS01

Receptor Information
>6zj3 Chain Lk (length=131) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKKAVFKRYNKIRTTVQFHRPYTRRTKGQKKYVRRSGRSVSIAQKKDQFH
ILKFPLTTESAMKKIEDNNTLVFIVDIRANKNQIKTAVRKMYDIKAARVN
TLIRPDGLKKAYVKLMPDNDALDIANKIGIL
Ligand information
>6zj3 Chain LA (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
accuguugugguggaugucuuggcccagguucugaggaaggacacagcag
ccuugcgauacguucggugauacgcagaucuugugaucuggacaaaggaa
cagcuucgaacgcaacuggccagcaagggguccccccgagcugccugugc
gccaguguug
.......................................<<<..<.((..
....>.........<<<......))............>>>..........
....>>>....<<.....>>.<<<..<<<<...>>>>..>>>........
..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		F50 P53 T55 R56 K62 R66 R70 I74 K77 K78 H82 R110 N114 R121 K122
Binding residue
(residue number reindexed from 1)		F18 P21 T23 R24 K30 R34 R38 I42 K45 K46 H50 R78 N82 R89 K90
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 04:45:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Lk', bs = 'BS01', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Lk', bs='BS01', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'Lk'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='Lk')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>