Structure of PDB 8bsi Chain Li Binding Site BS01

Receptor Information
>8bsi Chain Li (length=115) Species: 5741 (Giardia intestinalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLKAKDLVGLSQEDLQRKLADLKRELLSLRTMKATAIARFRVCKKDVARV
LTVINQKARDEARAAFEGAEHIPKTFRPRLTHAMRCQLTEKQKRLLPSKL
MKRKLQFPKLKYAVK
Ligand information
>8bsi Chain LD (length=137) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgccccgccggcggaugccucggcccgggcggcgacgaagagcgcggcg
gagcgcgagacgcggugcggacccgcccgccccgagaagcaccgauccuc
gaacgcagcgcgcccgcgccgccgccucggcgccugc
........................................<<<<<<.((.
....>>>.....<<<<<<...<..))..>.........>>>>>>...>>>
....<<...>><<..>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bsi Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		A34 K63 R77 K80 K81 R85 L87 T88 N91 R95 K110 R115 T117 H118 R121
Binding residue
(residue number reindexed from 1)		A4 K33 R41 K44 K45 R49 L51 T52 N55 R59 K74 R79 T81 H82 R85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bsi, PDBe:8bsi, PDBj:8bsi
PDBsum8bsi
PubMed36912103
UniProtA0A644FBK5

[Back to BioLiP]