Structure of PDB 8bsj Chain LZ Binding Site BS01

Receptor Information
>8bsj Chain LZ (length=133) Species: 5741 (Giardia intestinalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLNSAVTASRRKCRKAYFTANAETRAKMMSSRLSKELRAEHKIKTMPIR
RGDIVEIFTGGHKGTGKVVEVRRRDYKICVEGINQKARNPEAKPVPYPIH
PSNCIIKELYMNGSRYRAIKRRQERNAERLARI
Ligand information
>8bsj Chain LD (length=140) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacgccccgccggcggaugccucggcccgggcggcgacgaagagcgcggc
ggagcgcgagacgcggugcggacccgcccgccccgagaagcaccgauccu
cgaacgcagcgcgccccggcgccgccgccucggcgccugc
.........................................<<<<<<.((
.....>>>.....<<<<<<...<..))..>.........>>>>>>...>>
>....<<...>><<<..>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution6.49 Å
Binding residue
(original residue number in PDB)		R11 R12 R15 K16 F19 N22 A23 E24 R50 R51 V71 R73 R74 N112 G113 S114 Y116 R117
Binding residue
(residue number reindexed from 1)		R11 R12 R15 K16 F19 N22 A23 E24 R50 R51 V71 R73 R74 N112 G113 S114 Y116 R117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bsj, PDBe:8bsj, PDBj:8bsj
PDBsum8bsj
PubMed36912103
UniProtA8BFT3

[Back to BioLiP]