Structure of PDB 7mq9 Chain LZ Binding Site BS01

Receptor Information
>7mq9 Chain LZ (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQL
SRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFV
TASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVT
RSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
Ligand information
>7mq9 Chain L0 (length=242) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaucgauguggugacgucgugcucucccgggccggguccgcggaccccgg
cccgaccucgcgcgggguccucugacgcggcagacagcccucgcugucgc
cgacuugcgggcggccccccuccgcggcggugggggugccgucccgccgg
cccgugcgucggcuccgggcccuugcggugcuccuggagcgcuccggguu
gcaggugcccgaggccgaugagaaaagccuucucuagcgauc
...................<<.<<....<<<<<<<<<<<<>>>>>>>.>>
>>><<<<<<<..>>>>>>>....>>>>.<<<<<......>>.>>><<<<.
>>>>...<<<<<<<<<<<<<.<<<...>>>.>>>>>.>>>>>.>>>..<<
<<<<..>>..>>>>....................................
...............<<.>>......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mq9 Nucleolar maturation of the human small subunit processome.
Resolution3.87 Å
Binding residue
(original residue number in PDB)		K4 H29 R35 R36 Y37 N49 Q50 R53 R56 R60 F100 T102 A103 S104 R108 K117 R119 H123 Q125 R152
Binding residue
(residue number reindexed from 1)		K3 H28 R34 R35 Y36 N48 Q49 R52 R55 R59 F99 T101 A102 S103 R107 K116 R118 H122 Q124 R151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030515 snoRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030684 preribosome
GO:0032040 small-subunit processome
GO:0034457 Mpp10 complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mq9, PDBe:7mq9, PDBj:7mq9
PDBsum7mq9
PubMed34516797
UniProtQ9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 (Gene Name=IMP3)

[Back to BioLiP]