Structure of PDB 8ony Chain LY Binding Site BS01

Receptor Information
>8ony Chain LY (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIR
KDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
PSKVVITRLKLDKDRKKILERKAKSRQVG
Ligand information
>8ony Chain 5 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uugaaaagaacuuugaagagagaguucaagagggcguucaaacgagaacu
uugaauuccaugugaacagcaguugaacaugggucucggguucagauccc
cgaaucuuggaaagcgucgcgguuccggcggcguaagggcugguagcagc
cgacuu
..........<<<......>>>..............<<<<<<.......>
>>>>>..<<<<<<...<<.....>>.>>>>>>...<<<<<........>>
>>>..........<<<<<<<.......>>>>>>><<<<<<<<....>>>>
>..>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ony Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
Resolution2.92 Å
Binding residue
(original residue number in PDB)		R87 K89 A90
Binding residue
(residue number reindexed from 1)		R87 K89 A90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0034644 cellular response to UV
GO:0042273 ribosomal large subunit biogenesis
GO:0045727 positive regulation of translation
GO:0071479 cellular response to ionizing radiation
GO:0071480 cellular response to gamma radiation
GO:1902164 positive regulation of DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:1902167 positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:1904803 regulation of translation involved in cellular response to UV
Cellular Component
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ony, PDBe:8ony, PDBj:8ony
PDBsum8ony
PubMed38267453
UniProtP61254|RL26_HUMAN Large ribosomal subunit protein uL24 (Gene Name=RPL26)

[Back to BioLiP]