Structure of PDB 8br8 Chain LY Binding Site BS01

Receptor Information
>8br8 Chain LY (length=115) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTNVHFFRPKTLVHKKAPLYPRNPIKKGSWDDPCDLLRYPIKTDENTTQI
EKNNTIVFIVDRRASKPEIRKAFETVFETKVARVNTLITPLGLKKAFIRL
APDVQAMDVASKMGL
Ligand information
>8br8 Chain LD (length=142) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcacgccccgccggcggaugccucggcccgggcggcgacgaagagcgcgg
cggagcgcgagacgcggugcggacccgcccgccccgagaagcaccgaucc
ucgaacgcagcgcgccccggcgccgccgccucggcgccugcc
..........................................<<<<<<<(
(....>>>>.....<<<<<<...<..))..>.........>>>>>>...>
>>....<<...>><<<..>>>.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		T36 L37 H39 K40 K41 R47 N48 K52 R88
Binding residue
(residue number reindexed from 1)		T11 L12 H14 K15 K16 R22 N23 K27 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum8br8
PubMed36912103
UniProtA8BMP6

[Back to BioLiP]