Structure of PDB 8fkz Chain LW Binding Site BS01

Receptor Information

>8fkz Chain LW (length=77) Species: 9606 (Homo sapiens)

RRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTG
TGRMRHLKIVYRRFRHGFREGTTPKPK

Ligand information

>8fkz Chain L1 (length=154)

cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccgggccucccggggcuacgccugucugagcgu
cgcu

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>.............>>>..>...>>
>....<<....>><<<<<<<<<...>>>>>>>>>................
....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8fkz Principles of human pre-60 S biogenesis.
• Resolution: 3.04 Å
• Binding residue (original residue number in PDB): R20 R21 C22 G23 L29 Y39 K42 G60 G62 R63 M64 R65 H66 L67 R72 F74 H76 R79 G81 T82 T83 P84 K85 K87
• Binding residue (residue number reindexed from 1): R10 R11 C12 G13 L19 Y29 K32 G50 G52 R53 M54 R55 H56 L57 R62 F64 H66 R69 G71 T72 T73 P74 K75 K77

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0097371 MDM2/MDM4 family protein binding
• GO:1990948 ubiquitin ligase inhibitor activity

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:1901798 positive regulation of signal transduction by p53 class mediator

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fkz, PDBe:8fkz, PDBj:8fkz
• PDBsum: 8fkz
• PubMed: 37410842
• UniProt: P61927|RL37_HUMAN Large ribosomal subunit protein eL37 (Gene Name=RPL37)