Structure of PDB 8fkw Chain LW Binding Site BS01

Receptor Information

>8fkw Chain LW (length=74) Species: 9606 (Homo sapiens)

KTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGR
MRHLKIVYRRFRHGFREGTTPKPK

Ligand information

>8fkw Chain L1 (length=152)

acucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagcua
gcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuucg
aacgcacuugcggccccggguucccggggcuacgccugucugagcgucgc
uu

.......................................<<<<<<<<<..
..>>>>.....<.<<<......>>.............>>>..>...>>>.
...<<....>><<<<<<<<<..>>>>>>>>>...................
..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8fkw Principles of human pre-60 S biogenesis.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): R20 R21 Y27 Y39 T59 G62 R63 M64 R65 H66 L67 K68 R72 F74 H76 R79 E80 G81 T82 T83 P84 K85 K87
• Binding residue (residue number reindexed from 1): R7 R8 Y14 Y26 T46 G49 R50 M51 R52 H53 L54 K55 R59 F61 H63 R66 E67 G68 T69 T70 P71 K72 K74

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0097371 MDM2/MDM4 family protein binding
• GO:1990948 ubiquitin ligase inhibitor activity

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:1901798 positive regulation of signal transduction by p53 class mediator

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fkw, PDBe:8fkw, PDBj:8fkw
• PDBsum: 8fkw
• PubMed: 37410842
• UniProt: P61927|RL37_HUMAN Large ribosomal subunit protein eL37 (Gene Name=RPL37)