Structure of PDB 8fks Chain LW Binding Site BS01

Receptor Information

>8fks Chain LW (length=69) Species: 9606 (Homo sapiens)

KTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKAKAKRRNTTGTGRMRHL
KIVYRRFRHGFREGTTPKP

Ligand information

>8fks Chain L1 (length=152)

acucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagcua
gcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuucg
aacgcacuugcggccccggguucccggggcuacgccugucugagcgucgc
uu

.......................................<<<<<<<<<..
..>>>>.....<.<<<......>>.............>>>..>...>>>.
...<<....>><<<<<<<<<..>>>>>>>>>...................
..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8fks Principles of human pre-60 S biogenesis.
• Resolution: 2.88 Å
• Binding residue (original residue number in PDB): R20 R21 Y39 K44 T59 G62 R63 M64 R65 H66 L67 V70 R72 F74 H76 R79 E80 G81 T82 P84
• Binding residue (residue number reindexed from 1): R7 R8 Y26 K31 T42 G45 R46 M47 R48 H49 L50 V53 R55 F57 H59 R62 E63 G64 T65 P67

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0097371 MDM2/MDM4 family protein binding
• GO:1990948 ubiquitin ligase inhibitor activity

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:1901798 positive regulation of signal transduction by p53 class mediator

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fks, PDBe:8fks, PDBj:8fks
• PDBsum: 8fks
• PubMed: 37410842
• UniProt: P61927|RL37_HUMAN Large ribosomal subunit protein eL37 (Gene Name=RPL37)