Structure of PDB 8bjq Chain LS Binding Site BS01

Receptor Information
>8bjq Chain LS (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKV
KKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFP
LPHRVQKSTKTFSYKRPSTFY
Ligand information
>8bjq Chain C4 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bjq The dynamic architecture of Map1- and NatB-ribosome complexes coordinates the sequential modifications of nascent polypeptide chains.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R13 Y43 Q46 K47 H49 K50 K52 K53 R84 R117 R119
Binding residue
(residue number reindexed from 1)		R12 Y42 Q45 K46 H48 K49 K51 K52 R83 R116 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bjq, PDBe:8bjq, PDBj:8bjq
PDBsum8bjq
PubMed37079644
UniProtP0CX23|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]