Structure of PDB 9fpz Chain LR Binding Site BS01

Receptor Information
>9fpz Chain LR (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLII
RKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRI
LRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKAR
KKL
Ligand information
>9fpz Chain 1 (length=300) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caaguccuucugaucgaggcccagcccguggacggugugaggccgguagu
ugaaaagaacuuugaagagagaguucaagagggcgccgcccggaggauuc
aacccggcggcggguccggccgugucggcggcccggcggaucuuucccgc
gcgggggaccgucccccgaccggcgaccggccgccgccgggcgcauuucc
accgcggcgguucaaacgagaacuuugaaucggguucagauccccgaauc
uuggaaagcgucgcgguuccggcggcguaagggcugguagcagccgacuu
<....<<<<......>>>>.....((......<<<.....))>>>...>.
.........<<<<....>>>>..............<<<<<<<<.<<<...
..<<<<<<<<<<<..<<<<<<<..<....<.....<<<<.<<<..<<<..
..>>>>>>>>>>.>...>..>>>>...>>>>>>>>>>>>>>......>>>
.>>>.>>>>><<<<<<.......>>>>>><<<<<........>>>>>...
.......<<<<<<<.......>>>>>>><<<<<<<<....>>>>>..>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fpz Multi-protein assemblies orchestrate enzymatic processing of the nascent chain on the 80S ribosome
Resolution2.69 Å
Binding residue
(original residue number in PDB)		S2 M3 L4 K8 R9 L10 W23 L24 P26 S37 R38 Q39 R42 K43 K46 D47 R71 M76 R81 R88 R104 R108 Y109 K114 N134 K135 M139 H143
Binding residue
(residue number reindexed from 1)		S1 M2 L3 K7 R8 L9 W22 L23 P25 S36 R37 Q38 R41 K42 K45 D46 R70 M75 R80 R87 R103 R107 Y108 K113 N133 K134 M138 H142
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fpz, PDBe:9fpz, PDBj:9fpz
PDBsum9fpz
PubMed
UniProtP84098|RL19_HUMAN Large ribosomal subunit protein eL19 (Gene Name=RPL19)

[Back to BioLiP]