Structure of PDB 8ony Chain LR Binding Site BS01

Receptor Information
>8ony Chain LR (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLII
RKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRI
LRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKAR
KKL
Ligand information
>8ony Chain 5 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uugaaaagaacuuugaagagagaguucaagagggcguucaaacgagaacu
uugaauuccaugugaacagcaguugaacaugggucucggguucagauccc
cgaaucuuggaaagcgucgcgguuccggcggcguaagggcugguagcagc
cgacuu
..........<<<......>>>..............<<<<<<.......>
>>>>>..<<<<<<...<<.....>>.>>>>>>...<<<<<........>>
>>>..........<<<<<<<.......>>>>>>><<<<<<<<....>>>>
>..>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ony Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
Resolution2.92 Å
Binding residue
(original residue number in PDB)		R5 K8 L24 P26 R38 Q39 R42 K43 R71 R81 R108 R136 H143
Binding residue
(residue number reindexed from 1)		R4 K7 L23 P25 R37 Q38 R41 K42 R70 R80 R107 R135 H142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ony, PDBe:8ony, PDBj:8ony
PDBsum8ony
PubMed38267453
UniProtP84098|RL19_HUMAN Large ribosomal subunit protein eL19 (Gene Name=RPL19)

[Back to BioLiP]