Structure of PDB 8br8 Chain LQ Binding Site BS01

Receptor Information

>8br8 Chain LQ (length=154) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VKYAFKSDNLLVGKSRRDGVKASFKNTYSTCRAIKGMGVKRAFAYLDNVL
NHKEIVPFFKFYKGVGRHSQARGSGTDKGRWPEKSVVVVKDILKQAVSNA
KHAHKKEEDELYVISYCVNRARGRRRRTFRAHGRISKYESQPCHVELIVG
PKPL

Ligand information

>8br8 Chain LD (length=142) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcacgccccgccggcggaugccucggcccgggcggcgacgaagagcgcgg
cggagcgcgagacgcggugcggacccgcccgccccgagaagcaccgaucc
ucgaacgcagcgcgccccggcgccgccgccucggcgccugcc

..........................................<<<<<<<(
(....>>>>.....<<<<<<...<..))..>.........>>>>>>...>
>>....<<...>><<<..>>>.....................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution	3.35 Å
Binding residue (original residue number in PDB)	V2 K3 Y4 A5 K7 R33 F60 K61 Y63 N120 R123 H145
Binding residue (residue number reindexed from 1)	V1 K2 Y3 A4 K6 R32 F59 K60 Y62 N119 R122 H144

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum	8br8
PubMed	36912103
UniProt	A8BE76

[Back to BioLiP]