Structure of PDB 6yxm Chain LLL Binding Site BS01

Receptor Information
>6yxm Chain LLL (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLTLIQSRSVSGSPGQTVSISCTANGAHIGDSYVQWFQQRPGSAPRSVIF
EDDKRPSGVPDRLSGSTDFSSNSASLTISGLESEDEADYYCQSYYRGDWV
LGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTV
DWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVT
HEGHTVEKSLSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yxm Surface Ig variable domain glycosylation affects autoantigen binding and acts as threshold for human autoreactive B cell activation.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		G30 D31 S32 Y33 Y94 R96 G97 W99
Binding residue
(residue number reindexed from 1)		G30 D31 S32 Y33 Y94 R96 G97 W99
External links