Structure of PDB 8br8 Chain LH Binding Site BS01

Receptor Information

>8br8 Chain LH (length=213) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ERATEKEKRAALVKDHAVKSAQVYARYYIDLVESEKKARENALKNNQLYV
PDEPKVYLVVRIRGIVGVAPKVRTILSLLRLRQINNAVFMRCNKATLNAL
RIVDHYVTYGEPTVETIRNLIYKRGFAKVNGQRIPIVDNNLIDEQLSKHN
ILCAEDLVHEIFTCGSSFKEANNFLWPFQLNSAALKDKRNNFAEGGDFGY
RGKYINEFVARMI

Ligand information

>8br8 Chain LE (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aguucggccauccuacggcggaaacuccuuaacucguuccgaauuaggaa
gagaagcgccgucaggccccgccaguacugcgaucggagacgucguggga
acacggggugccgaacu

<<<<<<<<....<<<<<<<<....<<<<<<...............>>>..
>>>...>>>>>>.>><<<<<<......<<<<<<.<<....>>>>>>>>..
...>>>>>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution	3.35 Å
Binding residue (original residue number in PDB)	R123 H127 R211 N212 N213 E216 F220
Binding residue (residue number reindexed from 1)	R101 H105 R189 N190 N191 E194 F198

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum	8br8
PubMed	36912103
UniProt	A8BRY6

[Back to BioLiP]