Structure of PDB 8br8 Chain LG Binding Site BS01

Receptor Information
>8br8 Chain LG (length=50) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TANKTLSRKLRLAKKTKTNKNIPRWVIAKDHLKKTWNYKRHHWRRSHLKL
Ligand information
>8br8 Chain LD (length=142) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcacgccccgccggcggaugccucggcccgggcggcgacgaagagcgcgg
cggagcgcgagacgcggugcggacccgcccgccccgagaagcaccgaucc
ucgaacgcagcgcgccccggcgccgccgccucggcgccugcc
..........................................<<<<<<<(
(....>>>>.....<<<<<<...<..))..>.........>>>>>>...>
>>....<<...>><<<..>>>.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		S8 R12 K15 K18 T19 K21 I23 P24 W26 V27 K30 D31 H32 N38 K40
Binding residue
(residue number reindexed from 1)		S7 R11 K14 K17 T18 K20 I22 P23 W25 V26 K29 D30 H31 N37 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum8br8
PubMed36912103
UniProtA0A644EZB9

[Back to BioLiP]