BioLiP

Receptor Information

>8br8 Chain LF (length=293) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GWVKVQKTRSYFKRFQVQFRRRREGKTDYQARKALIIQDKNKYATPRYRF
VVRRTNKDIICQVTAAELTKDRVVCAAYSHELPRYGIPVGLTNYAAAYAT
GLLCGRRLLEKLSVGIKENALAQLYPGLDKATGEEYHPDENENEEVHAFK
AFLDIGLARASTGARVFAAMKGAVDAGLNIPHSMKRFPGYSKDGFDSSAL
RDRIMGKHVGDYMAELKAEDEETYRKRFSKYIAAKVEPLRLEAMYTKAHA
AIRANPQAVKAKFEIKKPVRQARLTLKERKERIDAKKLEALKQ

>8br8 Chain LE (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aguucggccauccuacggcggaaacuccuuaacucguuccgaauuaggaa
gagaagcgccgucaggccccgccaguacugcgaucggagacgucguggga
acacggggugccgaacu

<<<<<<<<....<<<<<<<<....<<<<<<...............>>>..
>>>...>>>>>>.>><<<<<<......<<<<<<.<<....>>>>>>>>..
...>>>>>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution	3.35 Å
Binding residue (original residue number in PDB)	K8 R10 F13 K14 F16 V18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 T70 K71 D72 R73 V74 Y79 N94 Y95 R160 S162 T163 G164 A165 R166 R204 H209 V210 Y213 R228 F229 S230 K231 Y232 K261 A262 F264 E265 I266 K267 K268 R271 Q272 R274 L275 L277 R280 R283 K287
Binding residue (residue number reindexed from 1)	K7 R9 F12 K13 F15 V17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 R53 T55 N56 K57 I60 Q62 T69 K70 D71 R72 V73 Y78 N93 Y94 R159 S161 T162 G163 A164 R165 R203 H208 V209 Y212 R227 F228 S229 K230 Y231 K260 A261 F263 E264 I265 K266 K267 R270 Q271 R273 L274 L276 R279 R282 K286

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum	8br8
PubMed	36912103
UniProt	E2RU47

[Back to BioLiP]

Structure of PDB 8br8 Chain LF Binding Site BS01