Structure of PDB 6t7i Chain LD Binding Site BS01

Receptor Information
>6t7i Chain LD (length=294) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>6t7i Chain C4 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<....<<<.<<<............>>>...
.>>...>>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t7i Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S13 S14 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 I69 T70 D72 G91 T93 N94 Q151 R152 A157 R158 Y198 H203 Y207 R218 E221 L222 K224 T256 K258 F260 K262 Q264 Y265 A266 E268 S269 K270 Y272 R273 Q274 T275 K276 L277 R282 K289
Binding residue
(residue number reindexed from 1)		S10 S11 F17 R18 R19 R21 K24 T25 Y27 R30 R47 R51 T53 N54 I66 T67 D69 G88 T90 N91 Q148 R149 A154 R155 Y195 H200 Y204 R215 E218 L219 K221 T253 K255 F257 K259 Q261 Y262 A263 E265 S266 K267 Y269 R270 Q271 T272 K273 L274 R279 K286
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t7i, PDBe:6t7i, PDBj:6t7i
PDBsum6t7i
PubMed31858614
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]