Structure of PDB 7ung Chain LB Binding Site BS01

Receptor Information
>7ung Chain LB (length=440) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVY
YNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN
WAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTL
LISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETY
CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADL
RKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTG
EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEA
Ligand information
>7ung Chain O (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANLAKRRHAELCRQKRVFNARNRII
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ung SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		D74 G79 T219
Binding residue
(residue number reindexed from 1)		D74 G79 T219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding
GO:0003924 GTPase activity
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0042288 MHC class I protein binding
GO:0046872 metal ion binding
GO:0051082 unfolded protein binding
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0000278 mitotic cell cycle
GO:0007017 microtubule-based process
GO:0030317 flagellated sperm motility
GO:0042267 natural killer cell mediated cytotoxicity
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005879 axonemal microtubule
GO:0015630 microtubule cytoskeleton
GO:0031514 motile cilium
GO:0035578 azurophil granule lumen
GO:0036126 sperm flagellum
GO:0045171 intercellular bridge
GO:0070062 extracellular exosome
GO:0072686 mitotic spindle
GO:1903561 extracellular vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ung, PDBe:7ung, PDBj:7ung
PDBsum7ung
PubMed36191189
UniProtP68371|TBB4B_HUMAN Tubulin beta-4B chain (Gene Name=TUBB4B)

[Back to BioLiP]