Structure of PDB 8fkx Chain LA Binding Site BS01

Receptor Information
>8fkx Chain LA (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMSSPCHIEMILTEKE
Ligand information
>8fkx Chain L1 (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagcua
gcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuucg
aacgcacuugcggccccggguucccggggcuacgccugucugagcgucgc
uu
.......................................<<<<<<<<<..
..>>>>.....<.<<<......>>.............>>>..>...>>>.
...<<....>><<<<<<<<<..>>>>>>>>>...................
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fkx Principles of human pre-60 S biogenesis.
Resolution2.59 Å
Binding residue
(original residue number in PDB)
R3 S5 R61 W78 N120 P123
Binding residue
(residue number reindexed from 1)
R2 S4 R60 W77 N119 P122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fkx, PDBe:8fkx, PDBj:8fkx
PDBsum8fkx
PubMed37410842
UniProtP18621|RL17_HUMAN Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]