Structure of PDB 8fkw Chain LA Binding Site BS01

Receptor Information
>8fkw Chain LA (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMSSPCHIEMILTEKE
Ligand information
>8fkw Chain L1 (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagcua
gcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuucg
aacgcacuugcggccccggguucccggggcuacgccugucugagcgucgc
uu
.......................................<<<<<<<<<..
..>>>>.....<.<<<......>>.............>>>..>...>>>.
...<<....>><<<<<<<<<..>>>>>>>>>...................
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fkw Principles of human pre-60 S biogenesis.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
R3 S5 R61 N120 P123
Binding residue
(residue number reindexed from 1)
R2 S4 R60 N119 P122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fkw, PDBe:8fkw, PDBj:8fkw
PDBsum8fkw
PubMed37410842
UniProtP18621|RL17_HUMAN Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]