Structure of PDB 8vs9 Chain L31 Binding Site BS01

Receptor Information
>8vs9 Chain L31 (length=45) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFT
Ligand information
>8vs9 Chain 5S (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugccuggcggccguagcgcgguggucccaccugaccccaugccgaacuca
gaagugaaacgccguagcgccgaugguaguguggggucuccccaugcgag
aguagggaacugccaggcaa
<<<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>>.<<.....<.<<<<<<<<...>>>>>>>>...
>...>>...>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		M1 K2 K3 D4 I5 H6
Binding residue
(residue number reindexed from 1)		M1 K2 K3 D4 I5 H6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vs9, PDBe:8vs9, PDBj:8vs9
PDBsum8vs9
PubMed38500588
UniProtC3SIV2

[Back to BioLiP]