Structure of PDB 9f1i Chain L Binding Site BS01

Receptor Information
>9f1i Chain L (length=217) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPASVEAAVGGTVTIKCQASQSISNYFSWYQQKPGQPPKLLIYK
ASTLASGVPSRFKGSGSGTEFTLTISDLECADAATYYCQSFYGSVTSDYG
GFAFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVT
VTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCK
VTQGTTSVVQSFNRGDC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9f1i Development of a first-in-class antibody and a specific assay for alpha-1,6-fucosylated prostate-specific antigen.
Resolution1.38 Å
Binding residue
(original residue number in PDB)		S30 Y32 F91 G93 S94 V95 T96 D98 G100
Binding residue
(residue number reindexed from 1)		S30 Y32 F91 G93 S94 V95 T96 D98 G100
External links