Structure of PDB 9at8 Chain L Binding Site BS01

Receptor Information
>9at8 Chain L (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVQLQESGPGLVKPSQSLSLTCTVSGYSITSDYAWNWIRQFPGNKLEWMG
YISYTLTTGYNPSLKSRISITRDSSKNQFFLQLNSVTTEDTATYYCARSG
WLLPYWYFDVWGAGTTVTVSS
Ligand information
>9at8 Chain E (length=21) Species: 645098 (Measles virus strain Ichinose-B95a) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QIHWGNLSKIGVVGIGSASYK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9at8 A neutralizing antibody prevents postfusion transition of measles virus fusion protein.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y54 T55 T57
Binding residue
(residue number reindexed from 1)		Y54 T55 T57
External links