Structure of PDB 8z9e Chain L Binding Site BS01

Receptor Information
>8z9e Chain L (length=138) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKVVLNINTDNMCNFASYRLMPFSGFIVEKRIEINDKNWFDMIWNEEYNK
MRSQHDKIIENIEYLFNIKILSKNRIKEFWAIKYITQVHRKNPNTGRRNW
NPPEGFTDNEIEKLYETAYNTLLSLDKNKVYNILINFN
Ligand information
>8z9e Chain N (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cagaacaccuaauuucgaauccagcaugagaagc
..................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z9e Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.13 Å
Binding residue
(original residue number in PDB)		S527 K528 N529 R530 N558 T559 N565
Binding residue
(residue number reindexed from 1)		S72 K73 N74 R75 N94 T95 N101
External links