Structure of PDB 8x1c Chain L Binding Site BS01

Receptor Information

>8x1c Chain L (length=105) Species: 9606 (Homo sapiens)

RVLDRAARQRRINRQLEALENDNFQDDPHAGLPNFQALLEEQNLSVAEGP
NYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRC
LKWTV

Ligand information

>8x1c Chain X (length=147)

acaggatgtatatatgtgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctccag

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8x1c Structure of nucleosome-bound SRCAP-C in the ADP-bound state
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): R17 R26
• Binding residue (residue number reindexed from 1): R1 R10

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0031491 nucleosome binding
• GO:0042393 histone binding
• GO:0046872 metal ion binding

Biological Process

• GO:0003015 heart process
• GO:0006325 chromatin organization
• GO:0006338 chromatin remodeling
• GO:0006355 regulation of DNA-templated transcription
• GO:0036335 intestinal stem cell homeostasis
• GO:0042692 muscle cell differentiation
• GO:0055074 calcium ion homeostasis
• GO:0060261 positive regulation of transcription initiation by RNA polymerase II
• GO:1902164 positive regulation of DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
• GO:1905458 positive regulation of lymphoid progenitor cell differentiation

Cellular Component

• GO:0000786 nucleosome
• GO:0000812 Swr1 complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm

External links

• PDB: RCSB:8x1c, PDBe:8x1c, PDBj:8x1c
• PDBsum: 8x1c
• PubMed: 38331872
• UniProt: O43257|ZNHI1_HUMAN Zinc finger HIT domain-containing protein 1 (Gene Name=ZNHIT1)