Structure of PDB 8wgh Chain L Binding Site BS01

Receptor Information
>8wgh Chain L (length=162) Species: 141305 (Fittonia albivenis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPGYRTAVDPLLRGIEV
GLAHGYLLVGPFVITGPLRNAPNHGAVGSLGAAGLIVILSITLTMYGIAS
FKEGDPSTAPSLTLTGRKKVPDPLQTADGWARFTGGFFFGGISGVIWAYF
LLYVLDLPYFVK
Ligand information
>8wgh Chain I (length=29) Species: 141305 (Fittonia albivenis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NLPSIFVPLVGLVFPAIAMASLFLHVQKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wgh Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI
Resolution2.4 Å
Binding residue
(original residue number in PDB)
M150 A154
Binding residue
(residue number reindexed from 1)
M95 A99
External links