Structure of PDB 8sps Chain L Binding Site BS01

Receptor Information
>8sps Chain L (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEA
LQLSFKNMCKLRPLLQKWVEEADNN
Ligand information
>8sps Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cctccccatgtgggacctggagaaacagagggtggagggagcatagagag
tctgttctaagctgcaaagcaaaggcctggcgacctaggagaccatggag
ttccagaaagtgatagttatgcagagcgaatggagggaatcagcacg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sps Structural mechanism of LIN28B nucleosome targeting by OCT4.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T163 Q164 Q181 T182 C185
Binding residue
(residue number reindexed from 1)		T24 Q25 Q42 T43 C46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0015144 carbohydrate transmembrane transporter activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0008643 carbohydrate transport
GO:0055085 transmembrane transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8sps, PDBe:8sps, PDBj:8sps
PDBsum8sps
PubMed37327775
UniProtQ01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)

[Back to BioLiP]