Structure of PDB 8rxb Chain L Binding Site BS01

Receptor Information
>8rxb Chain L (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKE
VTLHKDGPLGETVLECYNCGCRNVFLLGFIPDSVVVLLCRQPCASQSSQW
QPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxb UPF1 helicase orchestrates mutually exclusive interactions with the SMG6 endonuclease and UPF2.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L62 E68 V91 V92 L93
Binding residue
(residue number reindexed from 1)		L59 E65 V85 V86 L87
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0005524 ATP binding
GO:0008270 zinc ion binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxb, PDBe:8rxb, PDBj:8rxb
PDBsum8rxb
PubMed38709891
UniProtQ92900|RENT1_HUMAN Regulator of nonsense transcripts 1 (Gene Name=UPF1)

[Back to BioLiP]