Structure of PDB 8qpb Chain L Binding Site BS01

Receptor Information
>8qpb Chain L (length=376) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKLWDSKMFAEIMMKIEEYISKQAKASEVAAPEYRVIVDANNLTVEIENE
LNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQ
QILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYE
YVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQR
KTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVD
SFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGG
RRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGR
VRQTQVNEATKARISKTLQRTLQKQS
Ligand information
>8qpb Chain 4 (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugaggucuauccgaggcgcg
auuauugcuaauugaaaacuuuucccaaua
...................<<<<<.<<<.....<<.....>>..>>>>>>
>>............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qpb Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution3.7 Å
Binding residue
(original residue number in PDB)		M244 C247 N248 M250 L251 L252 R256 H270 R293 A297 K298 K327 K338 Q350 R351 K352 K353 R354 R357 R358 K361 R419 S421 K422 T423 Q431
Binding residue
(residue number reindexed from 1)		M188 C191 N192 M194 L195 L196 R200 H214 R237 A241 K242 K271 K282 Q294 R295 K296 K297 R298 R301 R302 K305 R363 S365 K366 T367 Q375
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0070990 snRNP binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0048254 snoRNA localization
GO:0071166 ribonucleoprotein complex localization
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005687 U4 snRNP
GO:0005690 U4atac snRNP
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071339 MLL1 complex
GO:0097526 spliceosomal tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpb, PDBe:8qpb, PDBj:8qpb
PDBsum8qpb
PubMed38778104
UniProtQ8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]