Structure of PDB 8ip0 Chain L Binding Site BS01

Receptor Information
>8ip0 Chain L (length=96) Species: 1147 (Synechocystis sp. PCC 6714) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EYAEIVYKIAQGFVLSKLSSKHPKLEREYNDKKEKVVNEAFLAIRSRTEK
QAFIDYFVSTLYPHVRQDEFVDFAQKLFQDTDEIRSLTLLALSSQY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ip0 Cryo-EM structure of type I-B Cascade bound to a PAM-containing dsDNA target at 3.6 angstrom resolution.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		E45 R85
Binding residue
(residue number reindexed from 1)		E26 R66
Enzymatic activity
Enzyme Commision number ?
External links