Structure of PDB 8igr Chain L Binding Site BS01

Receptor Information
>8igr Chain L (length=309) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAI
TYLLEQYDRVEAMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFL
DLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRI
PVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAK
EPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATHDVLAGLT
AREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPS
RSEVLRSFL
Ligand information
>8igr Chain N (length=61) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cctcgttgcgtttgtttgcacgaaccatatgtaagtatttccttagataa
caattgattga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8igr Structural basis of lambda CII-dependent transcription activation.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		M102 N383 R385 L386 F419 E420 R423 Y425 K426 S428 T429 Y430 T432 W433 Q437 R441 R451 P453 H455 V582 T583 E585 R586
Binding residue
(residue number reindexed from 1)		M11 N81 R83 L84 F117 E118 R121 Y123 K124 S126 T127 Y128 T130 W131 Q135 R139 R149 P151 H153 V280 T281 E283 R284
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009408 response to heat
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8igr, PDBe:8igr, PDBj:8igr
PDBsum8igr
PubMed37269829
UniProtP00579|RPOD_ECOLI RNA polymerase sigma factor RpoD (Gene Name=rpoD)

[Back to BioLiP]