Structure of PDB 8hil Chain L Binding Site BS01

Receptor Information

>8hil Chain L (length=46) Species: 3712 (Brassica oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EPVTYVCGDCGQENTLKSGDVIQCRECGYRILYKKRTRRVVQYEAR

Ligand information

InChI=1S/Zn/q+2

PTFCDOFLOPIGGS-UHFFFAOYSA-N

SMILES

Software	SMILES
CACTVS 3.341	[Zn++]
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Zn+2]

Formula

Zn

Name

ZINC ION

PDB chain

8hil Chain L Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8hil Structure and mechanism of the plant RNA polymerase V.
Resolution	3.57 Å
Binding residue (original residue number in PDB)	C12 C15 C29
Binding residue (residue number reindexed from 1)	C7 C10 C24
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001055	RNA polymerase II activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006366	transcription by RNA polymerase II
GO:0006383	transcription by RNA polymerase III

	Cellular Component
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005736	RNA polymerase I complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hil, PDBe:8hil, PDBj:8hil
PDBsum	8hil
PubMed	36893216
UniProt	A0A0D2ZPP3

[Back to BioLiP]