Structure of PDB 8h2u Chain L Binding Site BS01

Receptor Information

>8h2u Chain L (length=150) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AQVISPVNGDPFVGMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEIG
LAHGFLLAGPFIKLGPLRNVTAEIAGSLSAAGLVLILALCLSIYGSAQFQ
STPSIGVKTLSGRSVARDPLFSADGWSEFAAGFLVGGEAGVAWAYVCTQI

Ligand information

>8h2u Chain I (length=29) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SWAPSVFVPLTGLVLPAIAMATLFVYIEK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8h2u Three structures of PSI-LHCI from Chlamydomonas reinhardtii suggest a resting state re-activated by ferredoxin.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	I134 A138
Binding residue (residue number reindexed from 1)	I93 A97

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8h2u, PDBe:8h2u, PDBj:8h2u
PDBsum	8h2u
PubMed	37270022
UniProt	A8IL32

[Back to BioLiP]