Structure of PDB 8gho Chain L Binding Site BS01

Receptor Information
>8gho Chain L (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDIQLTQSPSSLSASVGDRVTITCRASESVDYYGSSLLQWYQQKPGKAPK
LLIYAASKLASGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQTRKAY
TFGQGTKLEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gho Molecular insights into recognition of GUCY2C by T-cell engaging bispecific antibody anti-GUCY2CxCD3.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y31 Y32 L36 R96 A98 Y99
Binding residue
(residue number reindexed from 1)		Y32 Y33 L37 R97 A99 Y100
External links