Structure of PDB 8ghm Chain L Binding Site BS01

Receptor Information
>8ghm Chain L (length=64) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILIDVPLYQADTNDYLDENGQVIFNLSTLIKEKYHLIGKYDVEDPFIDDS
ELLWEEKDGFFVYF
Ligand information
>8ghm Chain D (length=10) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MSMFNALNSN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ghm Structure of the Hir histone chaperone complex.
Resolution12.0 Å
Binding residue
(original residue number in PDB)		V596 Y597 F598
Binding residue
(residue number reindexed from 1)		V62 Y63 F64
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0031491 nucleosome binding
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:1905268 negative regulation of chromatin organization
Cellular Component
GO:0000417 HIR complex
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ghm, PDBe:8ghm, PDBj:8ghm
PDBsum8ghm
PubMed38925115
UniProtQ01448|HPC2_YEAST Histone promoter control protein 2 (Gene Name=HPC2)

[Back to BioLiP]