Structure of PDB 8fz2 Chain L Binding Site BS01

Receptor Information
>8fz2 Chain L (length=192) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIVLTQSPAVMSASPGERVTMTCSASSSVSYMYWYQQKPRSSPKPWIYLT
SNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSIPLTFGAG
TKLELKRTVAAPSVFIFPPSSVVCLLNNFYPREAKVQWKVDNALSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT
Ligand information
>8fz2 Chain P (length=20) Species: 401671 (HIV-1 M:B_89.6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KDLLELDKWASLWNWFDITN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fz2 Crystal structure of Fab460 in complex with MPER peptide
Resolution3.5 Å
Binding residue
(original residue number in PDB)
Y31 Y33 W90 S91
Binding residue
(residue number reindexed from 1)
Y31 Y33 W90 S91
External links