Structure of PDB 8ejl Chain L Binding Site BS01

Receptor Information

>8ejl Chain L (length=202) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLN
TVGGHQAAMQMLKETINEEAAEWDRLHPEPRGSDIAGTTSTLQEQIGWMT
HNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFY
KTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
GV

Ligand information

>8ejl Chain Y (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVLFPGQPFGQPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ejl A molecular switch modulates assembly and host factor binding of the HIV-1 capsid.
Resolution	3.9 Å
Binding residue (original residue number in PDB)	N57 N74 S102 T107
Binding residue (residue number reindexed from 1)	N50 N67 S83 T88

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:8ejl, PDBe:8ejl, PDBj:8ejl
PDBsum	8ejl
PubMed	36759579
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]