Structure of PDB 8dgv Chain L Binding Site BS01

Receptor Information
>8dgv Chain L (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGTLSLSAGERATLSCRASQTMTKNYVAWYQQKPGQAPRLLIYGASTRAT
GIPDRFSGSGSGTDFTLTISRLAPEDFAVYYCLQYGSSPPIFTFGPGTKV
EIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRG
Ligand information
>8dgv Chain A (length=18) Species: 1263720 (Betacoronavirus England 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NSTGIDFQDELDEFFKNV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dgv Broadly neutralizing anti-S2 antibodies protect against all three human betacoronaviruses that cause deadly disease.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y32 Y49 T53 Y91 G92 S93 P95A
Binding residue
(residue number reindexed from 1)
Y26 Y43 T47 Y85 G86 S87 P90
External links