Structure of PDB 8dgu Chain L Binding Site BS01

Receptor Information
>8dgu Chain L (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVLTQPPSVSAPPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIH
ENNQRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDTNLGAFV
FGAATRVTVLGQPKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT
HEGSTVEKTVAPT
Ligand information
>8dgu Chain A (length=14) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDSFKEELDKYFKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dgu Broadly neutralizing anti-S2 antibodies protect against all three human betacoronaviruses that cause deadly disease.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		N30 N31 Y32 K66 W91 T93
Binding residue
(residue number reindexed from 1)		N31 N32 Y33 K67 W92 T94
External links