Structure of PDB 8cbn Chain L Binding Site BS01

Receptor Information
>8cbn Chain L (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTRDFKPGDLIFAKMKGYPHWPARVDEVPPPTNKLPIFFFGTHETAFLGP
KDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVK
Ligand information
>8cbn Chain I (length=150) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcctgtgcat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cbn Multivalency of nucleosome recognition by LEDGF.
Resolution3.34 Å
Binding residue
(original residue number in PDB)		K14 M15 K16 G17 Y18 P19 K56 K73 R74
Binding residue
(residue number reindexed from 1)		K14 M15 K16 G17 Y18 P19 K51 K68 R69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0097100 supercoiled DNA binding
Biological Process
GO:0000395 mRNA 5'-splice site recognition
GO:0006338 chromatin remodeling
GO:0006979 response to oxidative stress
GO:0009408 response to heat
Cellular Component
GO:0000791 euchromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cbn, PDBe:8cbn, PDBj:8cbn
PDBsum8cbn
PubMed37615563
UniProtO75475|PSIP1_HUMAN PC4 and SFRS1-interacting protein (Gene Name=PSIP1)

[Back to BioLiP]