Structure of PDB 8a4i Chain L Binding Site BS01

Receptor Information
>8a4i Chain L (length=56) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQHCCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHY
MTHGAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a4i Structure of SALL4 zinc finger domain reveals link between AT-rich DNA binding and Okihiro syndrome.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		H898 T901 N922 H926
Binding residue
(residue number reindexed from 1)		H21 T24 N45 H49
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8a4i, PDBe:8a4i, PDBj:8a4i
PDBsum8a4i
PubMed36635047
UniProtQ8BX22|SALL4_MOUSE Sal-like protein 4 (Gene Name=Sall4)

[Back to BioLiP]