Structure of PDB 7yk5 Chain L Binding Site BS01

Receptor Information
>7yk5 Chain L (length=139) Species: 2850 (Phaeodactylum tricornutum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRLTQGCFSFLPDLTDQQIEKQIAYCITKGWAMNVEWTDDPHPRNSYWEL
WGLPLFDVKDPASVMFELREARKSCAAGYIRINAFNAAYGTESCVMSFIV
NRPSNEPGFYLERQELEGRRIAYTTKSYSVQANPEGGRY
Ligand information
>7yk5 Chain j (length=8) Species: 2850 (Phaeodactylum tricornutum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KWSPRGGS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yk5 A linker protein from a red-type pyrenoid phase separates with Rubisco via oligomerizing sticker motifs.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N105 N133 G137
Binding residue
(residue number reindexed from 1)		N105 N133 G137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0016984 ribulose-bisphosphate carboxylase activity
Biological Process
GO:0015977 carbon fixation
GO:0015979 photosynthesis
GO:0019253 reductive pentose-phosphate cycle
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yk5, PDBe:7yk5, PDBj:7yk5
PDBsum7yk5
PubMed37311001
UniProtA0T0E2

[Back to BioLiP]